HPA016856

SLC18A2 antibody from Sigma-Aldrich
SVAT, SVMT, VMAT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016856, RRID:AB_1857003
Product name
Anti-SLC18A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016856
Antibody type
Polyclonal
Antigen
Synaptic vesicular amine transporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSIKHEKNATEIQTARPVHTASISDSFQSIFSYYD
NSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCP
SEDKDLLNENVQVGLLFASKATVQLITNP
Storage
-20C
Provider Type Product Number
- No reagents -