Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055737-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055737-M02, RRID:AB_566269
- Product name
- VPS35 monoclonal antibody (M02), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant VPS35.
- Antigen sequence
MECLKKALKIANQCMDPSLQVQLFIEILNRYIYFY
EKENDAVTIQVLNQLIQKIREDLPNLESSEETEQI
NKHFHNTLEHLRLRRESPESEGPIYEGLIL- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Activity-regulated trafficking of the palmitoyl-acyl transferase DHHC5.
Retromer-dependent neurotransmitter receptor trafficking to synapses is altered by the Parkinson's disease VPS35 mutation p.D620N.
A combined transgenic proteomic analysis and regulated trafficking of neuroligin-2.
A novel, retromer-independent role for sorting nexins 1 and 2 in RhoG-dependent membrane remodeling.
Brigidi GS, Santyr B, Shimell J, Jovellar B, Bamji SX
Nature communications 2015 Sep 3;6:8200
Nature communications 2015 Sep 3;6:8200
Retromer-dependent neurotransmitter receptor trafficking to synapses is altered by the Parkinson's disease VPS35 mutation p.D620N.
Munsie LN, Milnerwood AJ, Seibler P, Beccano-Kelly DA, Tatarnikov I, Khinda J, Volta M, Kadgien C, Cao LP, Tapia L, Klein C, Farrer MJ
Human molecular genetics 2015 Mar 15;24(6):1691-703
Human molecular genetics 2015 Mar 15;24(6):1691-703
A combined transgenic proteomic analysis and regulated trafficking of neuroligin-2.
Kang Y, Ge Y, Cassidy RM, Lam V, Luo L, Moon KM, Lewis R, Molday RS, Wong RO, Foster LJ, Craig AM
The Journal of biological chemistry 2014 Oct 17;289(42):29350-64
The Journal of biological chemistry 2014 Oct 17;289(42):29350-64
A novel, retromer-independent role for sorting nexins 1 and 2 in RhoG-dependent membrane remodeling.
Prosser DC, Tran D, Schooley A, Wendland B, Ngsee JK
Traffic (Copenhagen, Denmark) 2010 Oct;11(10):1347-62
Traffic (Copenhagen, Denmark) 2010 Oct;11(10):1347-62
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- VPS35 monoclonal antibody (M02), clone 2D3. Western Blot analysis of VPS35 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged VPS35 is 0.03 ng/ml as a capture antibody.