HPA017956

JCAD antibody from Sigma-Aldrich
KIAA1462
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017956
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017956, RRID:AB_1852408
Product name
Anti-KIAA1462 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017956
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA1462 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTPGQEQGASELEGSLGEASTIEIPPGESLQARAA
RILGIEVAVESLLPGIRRAGQNQPAEPDASACTPE
SPQEELLSRPAPADVPRVSTDAFYGRRKCGWTKSP
LFVGDRDSARRAPQAFEHSDVDGVVTSTD
Storage
-20C
Provider Type Product Number
- No reagents -