Antibody data

Product number
H00055020-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055020-B01, RRID:AB_1204355
Product name
FLJ20699 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055020-B01
Antibody type
Polyclonal
Antigen
FLJ20699 (NP_060401, 1 a.a. ~ 469 a.a) full-length human protein.
Description
Mouse polyclonal antibody raised against a full-length human FLJ20699 protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MAAASPLRDCQAWKDARLPLSTTSNEACKLFDATL
TQYVKWTNDKSLGGIEGCLSKLKAADPTFVMGHAM
ATGLVLIGTGSSVKLDKELDLAVKTMVEISRTQPL
TRREQLHVSAVETFANGNFPKACELWEQILQDHPT
DMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPD
IPLSSYVKGIYSFGLMETNFYDQAEKLAKEALSIN
PTDAWSVHTVAHIHEMKAEIKDGLEFMQHSETLWK
DSDMLACHNYWHWALYLIEKGEYEAALTIYDTHIL
PSLQANDAMLDVVDSCSMLYRLQMEGVSVGQRWQD
VLPVARKHSRDHILLFNDAHFLMASLGAHDPQTTQ
ELLTTLRDASESPGENCQHLLARDVGLPLCQALVE
AEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQ
LLIHAALNCTSSVHKNVARSLLMERDALKPNSPLT
ERLIRKAATVHLMQ
Vial size
50 μL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -