HPA017856

AS3MT antibody from Sigma-Aldrich
CYT19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017856, RRID:AB_1847420
Product name
Anti-AS3MT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017856
Antibody type
Polyclonal
Antigen
Arsenite methyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKV
LWGECLGGALYWKELAVLAQKIGFCPPRLVTANLI
TIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRC
QVIYNGGITGHEKELMFDANFTFKEGEIVEVDEET
AAILK
Storage
-20C
Provider Type Product Number
- No reagents -