HPA027708

AS3MT antibody from MilliporeSigma / Merck KGaA
CYT19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027708
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027708, RRID:AB_10601335
Product name
Anti-AS3MT antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027708
Antibody type
Polyclonal
Antigen
arsenic (+3 oxidation state) methyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REALQNVHEEVALRYYGCGLVIPEHLENCWILDLG
SGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEK
YLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNES
HDIVVSNCVIN
Storage
-20C
Provider Type Product Number
- No reagents -