HPA017856

AS3MT antibody from Atlas Antibodies
CYT19
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017856
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017856, RRID:AB_1234073
Product name
Anti-AS3MT
Provider product page
Atlas Antibodies - HPA017856
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKV
LWGECLGGALYWKELAVLAQKIGFCPPRLVTANLI
TIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRC
QVIYNGGITGHEKELMFDANFTFKEGEIVEVDEET
AAILK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -