HPA015600

GAP43 antibody from Atlas Antibodies
B-50, PP46
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015600
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015600, RRID:AB_1849466
Product name
Anti-GAP43
Provider product page
Atlas Antibodies - HPA015600
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVA
DGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSE
EKKGEGDAATEQAAPQAPASSEEKAGSAETESATK
A
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -