HPA017303

ARPP21 antibody from Sigma-Aldrich
ARPP-21, R3HDM3, TARPP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017303
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017303, RRID:AB_1845049
Product name
Anti-ARPP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017303
Antibody type
Polyclonal
Antigen
cAMP-regulated phosphoprotein 21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEE
EKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVC
EESSARPGGESLQDQESIHLQLSSFSSLQEEDKSR
KDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT
Storage
-20C
Provider Type Product Number
- No reagents -