H00055687-B01

TRMU antibody from Abnova Corporation
FLJ10140, MTO2, TRMT

Antibody data

Product number
H00055687-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055687-B01, RRID:AB_1139053
Product name
TRMU MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055687-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TRMU protein.
Antigen sequence
MKKSLSRSTLRSPNGFSEIGLKLEMVSQDALRRTI
FPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFI
GKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGW
FLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPR
TDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMEC
HFRFRHQMALVCCVLQGGRVPGQREDPAAGAVCLH
APEGPAQSWDGH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -