Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - ELISA [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00000111-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00000111-M01, RRID:AB_605907
 - Product name
 - ADCY5 monoclonal antibody (M01), clone 3E6
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant ADCY5.
 - Antigen sequence
 ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVA
GVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVT
TDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNG
GPPLS- Isotype
 - IgG
 - Antibody clone number
 - 3E6
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		An adenylyl cyclase signaling pathway predicts direct dopaminergic input to vestibular hair cells.
				
		
	
			Drescher MJ, Cho WJ, Folbe AJ, Selvakumar D, Kewson DT, Abu-Hamdan MD, Oh CK, Ramakrishnan NA, Hatfield JS, Khan KM, Anne S, Harpool EC, Drescher DG
Neuroscience 2010 Dec 29;171(4):1054-74
		Neuroscience 2010 Dec 29;171(4):1054-74
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged ADCY5 is approximately 1ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol