HPA017730

ADCY5 antibody from Sigma-Aldrich
AC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017730
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017730, RRID:AB_1844595
Product name
Anti-ADCY5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017730
Antibody type
Polyclonal
Antigen
Adenylate cyclase type 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLKEHSIETFLTLRCTQKRKEEKAMIAKMNRQRTN
SIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFED
PKDKNAQESANPEDEVDEFLGRAIDARSIDRLRS
Storage
-20C
Provider Type Product Number
- No reagents -