HPA007054

FKBP8 antibody from Sigma-Aldrich
FKBP38, FKBPr38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007054
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007054, RRID:AB_1078876
Product name
Anti-FKBP8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007054
Antibody type
Polyclonal
Antigen
FK506-binding protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNL
AASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKG
KVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSK
LVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK
Storage
-20C
Provider Type Product Number
- No reagents -