Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006623-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006623-M01, RRID:AB_464249
- Product name
- SNCG monoclonal antibody (M01), clone 2C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SNCG.
- Antigen sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSV
AEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAV
TSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSG
GD- Isotype
- IgG
- Antibody clone number
- 2C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Adoptive transfer of immune cells from glaucomatous mice provokes retinal ganglion cell loss in recipients.
Gramlich OW, Ding QJ, Zhu W, Cook A, Anderson MG, Kuehn MH
Acta neuropathologica communications 2015 Sep 15;3:56
Acta neuropathologica communications 2015 Sep 15;3:56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG monoclonal antibody (M01), clone 2C3.Lane 1: SNCG transfected lysate(13.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SNCG monoclonal antibody (M01), clone 2C3. Western Blot analysis of SNCG expression in human spleen.