Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006623-M01A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006623-M01A, RRID:AB_1581209
- Product name
- SNCG monoclonal antibody (M01A), clone 2C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SNCG.
- Antigen sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSV
AEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAV
TSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSG
GD- Isotype
- IgG
- Antibody clone number
- 2C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SNCG monoclonal antibody (M01A), clone 2C3. Western Blot analysis of SNCG expression in human spleen.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG monoclonal antibody (M01A), clone 2C3.Lane 1: SNCG transfected lysate(13.3 KDa).Lane 2: Non-transfected lysate.