Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007368-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007368-A01, RRID:AB_627607
- Product name
- UGT8 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant UGT8.
- Antigen sequence
FESHMYIFKTLASALHERGHHTVFLLSEGRDIAPS
NHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTA
IELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLL
LVDPN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Axonopathy is a compounding factor in the pathogenesis of Krabbe disease.
Acute kidney injury induced by protein-overload nephropathy down-regulates gene expression of hepatic cerebroside sulfotransferase in mice, resulting in reduction of liver and serum sulfatides.
Castelvetri LC, Givogri MI, Zhu H, Smith B, Lopez-Rosas A, Qiu X, van Breemen R, Bongarzone ER
Acta neuropathologica 2011 Jul;122(1):35-48
Acta neuropathologica 2011 Jul;122(1):35-48
Acute kidney injury induced by protein-overload nephropathy down-regulates gene expression of hepatic cerebroside sulfotransferase in mice, resulting in reduction of liver and serum sulfatides.
Zhang X, Nakajima T, Kamijo Y, Li G, Hu R, Kannagi R, Kyogashima M, Aoyama T, Hara A
Biochemical and biophysical research communications 2009 Dec 25;390(4):1382-8
Biochemical and biophysical research communications 2009 Dec 25;390(4):1382-8
No comments: Submit comment
No validations: Submit validation data