HPA014405

UGT8 antibody from Sigma-Aldrich
CGT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014405
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014405, RRID:AB_1858606
Product name
Anti-UGT8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014405
Antibody type
Polyclonal
Antigen
2-hydroxyacylsphingosine 1-beta-galactosyltransferase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIF
NSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTK
NCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVI
AHLLGVKYAVFSTGLWYPAEVGAPA
Storage
-20C
Provider Type Product Number
- No reagents -