H00079036-B01

KXD1 antibody from Abnova Corporation
BORCS4, C19orf50, FLJ25480, KXDL, MGC2749

Antibody data

Product number
H00079036-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079036-B01, RRID:AB_1018405
Product name
MGC2749 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079036-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC2749 protein.
Antigen sequence
MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNML
DRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTL
VEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEA
SFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDT
VSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTG
E
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.