HPA009134

PDGFC antibody from Sigma-Aldrich
fallotein, SCDGF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009134
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009134, RRID:AB_10601981
Product name
Anti-PDGFC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009134
Antibody type
Polyclonal
Antigen
platelet derived growth factor C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYR
PTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKT
GVRGLHKSLTDVA
Storage
-20C
Provider Type Product Number
- No reagents -