H00022827-M02

PUF60 antibody from Abnova Corporation
FIR, RoBPI, SIAHBP1
No application information provided.

Antibody data

Product number
H00022827-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022827-M02, RRID:AB_1580599
Product name
SIAHBP1 monoclonal antibody (M02), clone 3H1
Provider product page
Abnova Corporation - H00022827-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SIAHBP1.
Antigen sequence
VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSV
TMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNI
KVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQ
DLSDD
Isotype
IgG
Antibody clone number
3H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -