HPA015601

CACNB4 antibody from Sigma-Aldrich
EJM4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015601
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015601, RRID:AB_1845873
Product name
Anti-CACNB4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015601
Antibody type
Polyclonal
Antigen
Voltage-dependent L-type calcium channel subunit beta-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHLGEYLEAYWRATHTTSSTPMTPLLGRNLGSTAL
SPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTS
DENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYP
DS
Storage
-20C
Provider Type Product Number
- No reagents -