HPA003173

ZNF680 antibody from Sigma-Aldrich
FLJ90430
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003173
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003173, RRID:AB_1080744
Product name
Anti-ZNF680 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003173
Antibody type
Polyclonal
Antigen
Zinc finger protein 680 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDTAQRNLYRKVMFENYRNLVFLGIAVSKPHLITC
LEQGKEPWNRKRQEMVAKPPVIYSHFTEDLWPEHS
IKDSFQKVILRGYGKCGHENLQLRISCKSVDESKV
FKEGYNELNQCLRTTQS
Storage
-20C
Provider Type Product Number
- No reagents -