ABIN501581

CRLF1 antibody from antibodies-online
CISS, CISS1, CLF, CLF-1

Antibody data

Product number
ABIN501581
Provider
antibodies-online
Product name
anti-Cytokine Receptor-Like Factor 1 (CRLF1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN501581
Antibody type
Polyclonal
Antigen
The immunogen for anti-CRLF1 antibody: synthetic peptide directed towards the middle region of human CRLF1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Zebrafish
Host
Rabbit
Antigen sequence
QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKV
VDDVS NQTSCRLAGL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -