Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501581 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytokine Receptor-Like Factor 1 (CRLF1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CRLF1 antibody: synthetic peptide directed towards the middle region of human CRLF1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Zebrafish
- Host
- Rabbit
- Antigen sequence
QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKV
VDDVS NQTSCRLAGL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Crisponi syndrome is caused by mutations in the CRLF1 gene and is allelic to cold-induced sweating syndrome type 1.
Crisponi L, Crisponi G, Meloni A, Toliat MR, Nurnberg G, Usala G, Uda M, Masala M, Hohne W, Becker C, Marongiu M, Chiappe F, Kleta R, Rauch A, Wollnik B, Strasser F, Reese T, Jakobs C, Kurlemann G, Cao A, Nurnberg P, Rutsch F
American journal of human genetics 2007 May;80(5):971-81
American journal of human genetics 2007 May;80(5):971-81
No comments: Submit comment
No validations: Submit validation data