HPA029502

GRAMD4 antibody from MilliporeSigma / Merck KGaA
DIP, KIAA0767
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029502
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029502, RRID:AB_10602232
Product name
Anti-GRAMD4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029502
Antibody type
Polyclonal
Antigen
GRAM domain containing 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYDTPYIIWRSLPTDPQLKERSSAAVSRRLQTTSS
RSYVPSAPAGLGKEEDAGRFHSTKKGNFHEIFNLT
ENERPLAVCENGWRCCLINRDRKMPTDYIRNGVLY
Storage
-20C
Provider Type Product Number
- No reagents -