HPA015858

PCLO antibody from Atlas Antibodies
ACZ, DKFZp779G1236, KIAA0559
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015858
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015858, RRID:AB_1855071
Product name
Anti-PCLO
Provider product page
Atlas Antibodies - HPA015858
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IYQYNYDPSGTASPQTTTEQAILEGQYAALEGSQF
WATEDATTTASAVVAIEIPQSQGWYTVQSDGVTQY
IAPPGILSTVSEIPLTDVVVKEEKQPKKRSSGAKV
RGQYDDMGENMTDDPRSFKKIVDSGVQTDDE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -