H00010318-B01P

TNIP1 antibody from Abnova Corporation
ABIN-1, KIAA0113, NAF1, VAN

Antibody data

Product number
H00010318-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010318-B01P, RRID:AB_1581418
Product name
TNIP1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010318-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TNIP1 protein.
Antigen sequence
MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRL
KEKMQGIKMLGELLEESQMEATRLRQKAEELVKDN
ELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPAC
PSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSS
HANAMALGPLPREDGNLMLHLQRLETTLSVCAEEP
DHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQT
LCEQLRKENEALKAKLDKGLEQRDQAAERLREENL
ELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQ
QQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLE
VNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVT
DLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLT
AEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQEL
VTQNELLKQQVKIFEEDFQRERSDRERMNEEKEEL
KKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQK
RKAKASGERYHVEPHPEHLCGAYPYAYPPMPAMVP
HHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPE
YTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKN
DREGPQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -