HPA013977

SLC6A9 antibody from Atlas Antibodies
GLYT1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013977
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013977, RRID:AB_1849835
Product name
Anti-SLC6A9
Provider product page
Atlas Antibodies - HPA013977
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSH
LLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -