HPA031980

antibody from Atlas Antibodies

Targeting: ABCC11 MRP8

Antibody data

Submit

Validation data

Product number: HPA031980 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031980, RRID:AB_10602303
Product name: Anti-ABCC11
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVN GALELERNGHASEGMTRPRDALGPEEEGNSLGPEL HKINLVVSK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ABCC11 protein structure - HPA031980 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong, granular cytoplasmic positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong membranous positivity in bile duct cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows low positivity in cells in granular layer as expected.
Sample type: HUMAN