Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00085320-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00085320-M02, RRID:AB_1203928
- Product name
- ABCC11 monoclonal antibody (M02), clone 4H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ABCC11.
- Antigen sequence
FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTL
QDPSKALVFEEATLSWQQTCPGIVNGALELERNGH
ASEGMTRPRDALGPEEEGNSLGPELHKINL- Isotype
- IgG
- Antibody clone number
- 4H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Salinomycin overcomes ABC transporter-mediated multidrug and apoptosis resistance in human leukemia stem cell-like KG-1a cells.
Fuchs D, Daniel V, Sadeghi M, Opelz G, Naujokat C
Biochemical and biophysical research communications 2010 Apr 16;394(4):1098-104
Biochemical and biophysical research communications 2010 Apr 16;394(4):1098-104
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ABCC11 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ABCC11 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol