H00026270-M02A

FBXO6 antibody from Abnova Corporation
FBG2, FBS2, FBX6, Fbx6b

Antibody data

Product number
H00026270-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026270-M02A, RRID:AB_1016779
Product name
FBXO6 monoclonal antibody (M02A), clone 7D1
Provider product page
Abnova Corporation - H00026270-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FBXO6.
Antigen sequence
MDAPHSKAALDSINELPENILLELFTHVPARQLLL
NCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQ
PVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDF
NGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMC
LKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARA
DCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNN
ATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGW
YGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEE
AAQSPYRAVVQIF
Isotype
IgM
Antibody clone number
7D1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -