HPA031510

STK19 antibody from MilliporeSigma / Merck KGaA
D6S60, G11, RP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031510
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031510, RRID:AB_10603119
Product name
Anti-STK19 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031510
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 19 (Protein RP1)(EC 2.7.11.1) (Protein G11) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVAT
GAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Storage
-20C
Provider Type Product Number
- No reagents -