Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009852-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009852-M01, RRID:AB_565697
- Product name
- EPM2AIP1 monoclonal antibody (M01), clone 3H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPM2AIP1.
- Antigen sequence
TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKG
VACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTD
EHLQALFRVATTEMEPGWDDLVRERNESN- Isotype
- IgG
- Antibody clone number
- 3H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Deficiency of a glycogen synthase-associated protein, Epm2aip1, causes decreased glycogen synthesis and hepatic insulin resistance.
Turnbull J, Tiberia E, Pereira S, Zhao X, Pencea N, Wheeler AL, Yu WQ, Ivovic A, Naranian T, Israelian N, Draginov A, Piliguian M, Frankland PW, Wang P, Ackerley CA, Giacca A, Minassian BA
The Journal of biological chemistry 2013 Nov 29;288(48):34627-37
The Journal of biological chemistry 2013 Nov 29;288(48):34627-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EPM2AIP1 monoclonal antibody (M01), clone 3H7 Western Blot analysis of EPM2AIP1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EPM2AIP1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol