ABIN631877

antibody from antibodies-online

Targeting: APOBEC4 C1orf169, FLJ25691, MGC26594, RP1-127C7.4

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631877 - Provider product page
Provider: antibodies-online
Product name: anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4) antibody
Antibody type: Polyclonal
Antigen: ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

APOBEC4 protein structure - ABIN631877 shown in red.