ABIN1449899
antibody from antibodies-online
Targeting: APOBEC4
C1orf169, FLJ25691, MGC26594, RP1-127C7.4
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449899 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N terminal of human APOBEC4
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYL
DSAIYNNDSIRHIIL- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Lung; WB Suggested Anti-APOBEC4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Lung; APOBEC4 antibody - N-terminal region (AP45646PU-N) in Human Lung cells using Western Blot