HPA015637

APOBEC4 antibody from Sigma-Aldrich
C1orf169, FLJ25691, MGC26594, RP1-127C7.4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015637
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015637, RRID:AB_1844941
Product name
Anti-APOBEC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015637
Antibody type
Polyclonal
Antigen
Putative C->U-editing enzyme APOBEC-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFLITYPGITLSIYFSQLYHTEMDFPASAWNREAL
RSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSH
VFQPILTGRALADRHNAYEINAITGVKPYFTDVLL
QTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQL
QPNLPPDL
Storage
-20C
Provider Type Product Number
- No reagents -