HPA013979

CYTH3 antibody from Sigma-Aldrich
ARNO3, cytohesin-3, GRP1, PSCD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013979
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013979, RRID:AB_1855799
Product name
Anti-CYTH3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013979
Antibody type
Polyclonal
Antigen
Cytohesin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELID
DIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIA
M
Storage
-20C
Provider Type Product Number
- No reagents -