HPA013979

CYTH3 antibody from Atlas Antibodies
ARNO3, cytohesin-3, GRP1, PSCD3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013979
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013979, RRID:AB_1235369
Product name
Anti-CYTH3
Provider product page
Atlas Antibodies - HPA013979
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELID
DIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIA
M
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -