HPA014141

SYPL1 antibody from Sigma-Aldrich
SYPL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014141
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014141, RRID:AB_1857716
Product name
Anti-SYPL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014141
Antibody type
Polyclonal
Antigen
Synaptophysin-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATGHNIIDELPPCKKKAVLCYFGSVTSMGS
Storage
-20C
Provider Type Product Number
- No reagents -