Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057085-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057085-M02, RRID:AB_529952
- Product name
- AGTRAP monoclonal antibody (M02), clone 1G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AGTRAP.
- Antigen sequence
HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAP
ADPFAVPEGRSQDARGS- Isotype
- IgG
- Antibody clone number
- 1G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AGTRAP monoclonal antibody (M02), clone 1G2 Western Blot analysis of AGTRAP expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AGTRAP expression in transfected 293T cell line by AGTRAP monoclonal antibody (M02), clone 1G2.Lane 1: AGTRAP transfected lysate(16.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AGTRAP is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to AGTRAP on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.8 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol