Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051586-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051586-M02, RRID:AB_530166
- Product name
- PCQAP monoclonal antibody (M02), clone 4A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCQAP.
- Antigen sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHS
KSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIH
NKKSQASVSDPMNALQSL- Isotype
- IgG
- Antibody clone number
- 4A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MED19 and MED26 are synergistic functional targets of the RE1 silencing transcription factor in epigenetic silencing of neuronal gene expression.
TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
Ding N, Tomomori-Sato C, Sato S, Conaway RC, Conaway JW, Boyer TG
The Journal of biological chemistry 2009 Jan 30;284(5):2648-2656
The Journal of biological chemistry 2009 Jan 30;284(5):2648-2656
TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
Varelas X, Sakuma R, Samavarchi-Tehrani P, Peerani R, Rao BM, Dembowy J, Yaffe MB, Zandstra PW, Wrana JL
Nature cell biology 2008 Jul;10(7):837-48
Nature cell biology 2008 Jul;10(7):837-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MED15 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PCQAP on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol