HPA003179

MED15 antibody from Atlas Antibodies
Arc105, CAG7A, PCQAP, TIG-1, TNRC7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003179
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003179, RRID:AB_611690
Product name
Anti-MED15
Provider product page
Atlas Antibodies - HPA003179
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKT
RDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQ
SLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQ
PMSLSGQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -