HPA003179

MED15 antibody from Atlas Antibodies
Arc105, CAG7A, PCQAP, TIG-1, TNRC7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003179
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003179, RRID:AB_1079581
Product name
Anti-MED15
Provider product page
Atlas Antibodies - HPA003179
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKT
RDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQ
SLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQ
PMSLSGQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -