HPA003179

MED15 antibody from Sigma-Aldrich
Arc105, CAG7A, PCQAP, TIG-1, TNRC7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003179
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003179, RRID:AB_1079581
Product name
Anti-MED15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003179
Antibody type
Polyclonal
Antigen
Mediator of RNA polymerase II transcription subunit 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKT
RDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQ
SLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQ
PMSLSGQP
Storage
-20C
Provider Type Product Number
- No reagents -