HPA014002

TSPAN9 antibody from Sigma-Aldrich
NET-5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014002
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014002, RRID:AB_2304038
Product name
Anti-TSPAN9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014002
Antibody type
Polyclonal
Antigen
Tetraspanin-9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWY
PVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYE
KVKMWFDD
Storage
-20C
Provider Type Product Number
- No reagents -