H00153201-M12

SLC36A2 antibody from Abnova Corporation
PAT2, TRAMD1, tramdorin
No application information provided.

Antibody data

Product number
H00153201-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00153201-M12, RRID:AB_1137461
Product name
SLC36A2 monoclonal antibody (M12), clone 2B7
Provider product page
Abnova Corporation - H00153201-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC36A2.
Antigen sequence
MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDS
TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGT
G
Isotype
IgG
Antibody clone number
2B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -