HPA014272

TMCC3 antibody from Sigma-Aldrich
KIAA1145
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014272
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014272, RRID:AB_1858059
Product name
Anti-TMCC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014272
Antibody type
Polyclonal
Antigen
Transmembrane and coiled-coil domains protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGAST
LDSQGKLAVILEELREIKDTQAQLAEDIEALKVQF
KREYGFISQTLQEERYRYERLE
Storage
-20C
Provider Type Product Number
- No reagents -