Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503055 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ceramide Synthase 1 (CERS1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LASS1 antibody: synthetic peptide directed towards the middle region of human LASS1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPS
KAEKP LRNGLVKDKR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Defects in cell growth regulation by C18:0-ceramide and longevity assurance gene 1 in human head and neck squamous cell carcinomas.
Koybasi S, Senkal CE, Sundararaj K, Spassieva S, Bielawski J, Osta W, Day TA, Jiang JC, Jazwinski SM, Hannun YA, Obeid LM, Ogretmen B
The Journal of biological chemistry 2004 Oct 22;279(43):44311-9
The Journal of biological chemistry 2004 Oct 22;279(43):44311-9
No comments: Submit comment
No validations: Submit validation data