HPA013993

antibody from Atlas Antibodies

Targeting: RBM7

Antibody data

Submit

Validation data

Product number: HPA013993 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA013993, RRID:AB_1856137
Product name: Anti-RBM7
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQ DVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSS AQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGS SPLDQSGFSPSVQSHSHSFNQSSSSQW
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RBM7 protein structure - HPA013993 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using HPA013993 antibody. Corresponding RBM7 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Sample type: HUMAN