H00006143-M01
antibody from Abnova Corporation
Targeting: RPL19
DKFZp779D216, FLJ27452, L19, MGC71997
Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [4]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006143-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006143-M01, RRID:AB_509253
- Product name
- RPL19 monoclonal antibody (M01), clone 3H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RPL19.
- Antigen sequence
MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANA
NSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLAR
RKGRHMGIGKRKGTANARMPEKVTWMRRMR- Isotype
- IgG
- Antibody clone number
- 3H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inhibition of autophagy, lysosome and VCP function impairs stress granule assembly.
Substitution p.A350V in Na⁺/Mg²⁺ exchanger SLC41A1, potentially associated with Parkinson's disease, is a gain-of-function mutation.
Identification and expression of an autosomal paralogue of ribosomal protein S4, X-linked, in mice: potential involvement of testis-specific ribosomal proteins in translation and spermatogenesis.
siRNA knockdown of ribosomal protein gene RPL19 abrogates the aggressive phenotype of human prostate cancer.
A conserved SET domain methyltransferase, Set11, modifies ribosomal protein Rpl12 in fission yeast.
Seguin SJ, Morelli FF, Vinet J, Amore D, De Biasi S, Poletti A, Rubinsztein DC, Carra S
Cell death and differentiation 2014 Dec;21(12):1838-51
Cell death and differentiation 2014 Dec;21(12):1838-51
Substitution p.A350V in Na⁺/Mg²⁺ exchanger SLC41A1, potentially associated with Parkinson's disease, is a gain-of-function mutation.
Kolisek M, Sponder G, Mastrototaro L, Smorodchenko A, Launay P, Vormann J, Schweigel-Röntgen M
PloS one 2013;8(8):e71096
PloS one 2013;8(8):e71096
Identification and expression of an autosomal paralogue of ribosomal protein S4, X-linked, in mice: potential involvement of testis-specific ribosomal proteins in translation and spermatogenesis.
Sugihara Y, Sadohara E, Yonezawa K, Kugo M, Oshima K, Matsuda T, Nadano D
Gene 2013 May 25;521(1):91-9
Gene 2013 May 25;521(1):91-9
siRNA knockdown of ribosomal protein gene RPL19 abrogates the aggressive phenotype of human prostate cancer.
Bee A, Brewer D, Beesley C, Dodson A, Forootan S, Dickinson T, Gerard P, Lane B, Yao S, Cooper CS, Djamgoz MB, Gosden CM, Ke Y, Foster CS
PloS one 2011;6(7):e22672
PloS one 2011;6(7):e22672
A conserved SET domain methyltransferase, Set11, modifies ribosomal protein Rpl12 in fission yeast.
Sadaie M, Shinmyozu K, Nakayama J
The Journal of biological chemistry 2008 Mar 14;283(11):7185-95
The Journal of biological chemistry 2008 Mar 14;283(11):7185-95
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RPL19 monoclonal antibody (M01), clone 3H4 Western Blot analysis of RPL19 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RPL19 expression in transfected 293T cell line by RPL19 monoclonal antibody (M01), clone 3H4.Lane 1: RPL19 transfected lysate (Predicted MW: 23.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RPL19 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RPL19 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol