PAB20683

NEBL antibody from Abnova Corporation
bA165O3.1, C10orf113, LASP2, LNEBL

Antibody data

Product number
PAB20683
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20683, RRID:AB_10962753
Product name
NEBL polyclonal antibody
Provider product page
Abnova Corporation - PAB20683
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant NEBL.
Antigen sequence
CTELISDIRYKEEFKKSKDKCTFVTDSPMLNHVKN
IGAFISEAKYKGTIKADLSNSLYKRMPATIDSVFA
GEVTQLQSEVAYKQKHDAAKGFSDYAHMKEPPEVK
HAMEVNKHQSNISYRKDVQDTHTYSAELDRPD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.