HPA013995

NEBL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013995
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013995, RRID:AB_1854360
Product name
Anti-NEBL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013995
Antibody type
Polyclonal
Antigen
Nebulette recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQGIMNKEPAVIGRPDFEHAVEASKLSSQIKYKEK
FDNEMKDKKHHYNPLESASFRQNQLAATLASNVKY
KKDIQNMHDPVSDLPNLLFLDHVLKASKMLSGREY
KKLFEENKGMYHFDADAVEHLHHKGNAVLQ
Storage
-20C
Provider Type Product Number
- No reagents -