HPA013995

NEBL antibody from MilliporeSigma / Merck KGaA
bA165O3.1, C10orf113, LASP2, LNEBL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013995
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-NEBL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013995
Antibody type
Polyclonal
Antigen
Nebulette recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQGIMNKEPAVIGRPDFEHAVEASKLSSQIKYKEK
FDNEMKDKKHHYNPLESASFRQNQLAATLASNVKY
KKDIQNMHDPVSDLPNLLFLDHVLKASKMLSGREY
KKLFEENKGMYHFDADAVEHLHHKGNAVLQ
Storage
-20C